Atlas Antibodies Anti-CD7 Antibody

상품 한눈에 보기

Human CD7 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었으며, PrEST 항원으로 정제되었습니다. 40% 글리세롤 기반 PBS 버퍼에 보존되어 있습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039079-100 Anti-CD7 Antibody, CD7 molecule 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039079-25 Anti-CD7 Antibody, CD7 molecule 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CD7 Antibody

Anti-CD7 Antibody

Target Information

Target Protein: CD7 molecule
Target Gene: CD7
Alternative Gene Names: GP40, LEU-9, Tp40, TP41

Product Description

Polyclonal antibody against human CD7, validated for immunohistochemistry (IHC) through orthogonal comparison with RNA-seq expression data in high and low expression tissues.

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
YTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAAS

Species Reactivity

Verified Species: Human
Interspecies Identity:
- Mouse (ENSMUSG00000040289): 33%
- Rat (ENSRNOG00000031368): 32%

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.