CacheBy
Atlas Antibodies Anti-CD300C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CD300C Antibody

상품 한눈에 보기

Human CD300C 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. 재조합 발현 단백질로 검증되었으며, 친화 정제를 통해 높은 특이성과 재현성을 제공합니다. PBS/glycerol 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060349-100 Anti-CD300C Antibody, CD300c molecule 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060349-25 Anti-CD300C Antibody, CD300c molecule 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CD300C Antibody

Anti-CD300C Antibody

Target Information

  • Target Protein: CD300c molecule
  • Target Gene: CD300C
  • Alternative Gene Names: CMRF-35A, CMRF35, CMRF35A, IGSF16, LIR

Product Description

Polyclonal antibody against human CD300C, validated for use in immunohistochemistry (IHC) and Western blot (WB) using recombinant expression systems.

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression Validation)
    Recombinant expression validation in WB using target protein overexpression.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR

Species Reactivity

  • Verified Species: Human
  • Interspecies Identity:
    • Rat ENSRNOG00000046216 (36%)
    • Mouse ENSMUSG00000044811 (35%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Open Datasheet

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.