CacheBy
Atlas Antibodies Anti-CD300A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CD300A Antibody

상품 한눈에 보기

휴먼 CD300A 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG로 PrEST 항원을 이용해 친화 정제되었으며, 고순도의 신뢰성 있는 결과를 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011645-100 Anti-CD300A Antibody, CD300a molecule 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011645-25 Anti-CD300A Antibody, CD300a molecule 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CD300A Antibody

Anti-CD300A Antibody

Target Information

  • Target Protein: CD300a molecule
  • Target Gene: CD300A
  • Alternative Gene Names: CMRF-35-H9, CMRF35H, IGSF12, IRC1, IRC2, Irp60

Product Description

Polyclonal antibody against human CD300A.

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Information:
    • Rat ENSRNOG00000057058 (41%)
    • Mouse ENSMUSG00000034652 (31%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.