CacheBy
Atlas Antibodies Anti-CD1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CD1A Antibody

상품 한눈에 보기

인체 CD1A 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. Rabbit에서 생산된 IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. RNA-seq 기반 직교 검증으로 신뢰성 높은 결과를 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010734-100 Anti-CD1A Antibody, CD1a molecule 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010734-25 Anti-CD1A Antibody, CD1a molecule 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CD1A Antibody

Anti-CD1A Antibody

Target Information

  • Target Protein: CD1a molecule
  • Target Gene: CD1A
  • Alternative Gene Names: CD1

Product Description

Polyclonal antibody against human CD1A, designed for reliable detection of CD1a molecule in research applications.

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Identity:
    • Mouse ENSMUSG00000028076 (37%)
    • Rat ENSRNOG00000016451 (35%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Information

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.