Atlas Antibodies Anti-CCNH Antibody

상품 한눈에 보기

Human CCNH 단백질을 인식하는 폴리클로날 항체로, cyclin H 연구에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증되었으며, 높은 설치류 상동성을 보입니다. ICC 등 응용에 권장됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044138-100 Anti-CCNH Antibody, cyclin H 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044138-25 Anti-CCNH Antibody, cyclin H 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human CCNH (cyclin H).
Recommended for immunocytochemistry (ICC) and related applications.

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
Antigen Sequence:
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELL

Verified Species: Human
Ortholog Identity:
- Rat (ENSRNOG00000031656): 98%
- Mouse (ENSMUSG00000021548): 97%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.