CacheBy
Atlas Antibodies Anti-CCNF Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CCNF Antibody

상품 한눈에 보기

Human CCNF 단백질을 인식하는 Rabbit Polyclonal 항체로, Cyclin F 단백질 검출에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 대한 검증 완료, ICC 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA071600-100 Anti-CCNF Antibody, cyclin F 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071600-25 Anti-CCNF Antibody, cyclin F 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CCNF Antibody

Anti-CCNF Antibody

Target Protein: cyclin F
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against Human CCNF (Cyclin F).
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

FBX1, FBXO1


  • ICC (Immunocytochemistry)

Target Information

  • Target Protein: cyclin F
  • Target Gene: CCNF
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
YRQVSLTAVKQRFEDKRYGEISQEEVLSYSQLCAALGVTQDSPDPPTFLSTGEIHAFLSSPSGRRTKRKREN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000007483 (82%)
  • Mouse ENSMUSG00000072082 (78%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Verified Reactivity Human
Storage Gently mix before use; store as recommended by manufacturer

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet
Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.