
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CCNC Antibody
상품 한눈에 보기
인간 CCNC 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. Rabbit 유래 IgG 형태이며, PrEST 항원으로 친화 정제되었습니다. 높은 종간 보존성을 보여 Mouse 및 Rat에서도 100% 동일성을 가집니다.
- 카탈로그번호
- HPA069322-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA069322-100 Anti-CCNC Antibody, cyclin C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069322-25 Anti-CCNC Antibody, cyclin C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CCNC Antibody
Anti-CCNC Antibody
Target Information
- Target Protein: cyclin C
- Target Gene: CCNC
- Alternative Gene Names: CycC
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human CCNC.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:GNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGE
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000028252 (100%)
- Rat ENSRNOG00000007719 (100%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Open Datasheet
Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



