AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CCDC47 Antibody
상품 한눈에 보기
Human CCDC47 단백질을 인식하는 토끼 폴리클로날 항체로, WB, IHC, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 사람, 생쥐, 랫드에 반응합니다. 40% 글리세롤 PBS 버퍼에 보존되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA072573-100 Anti-CCDC47 Antibody, coiled-coil domain containing 47 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA072573-25 Anti-CCDC47 Antibody, coiled-coil domain containing 47 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CCDC47 Antibody
Anti-CCDC47 Antibody
Target: coiled-coil domain containing 47 (CCDC47)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, independently validated)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human CCDC47.
Alternative Gene Names
- GK001
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | coiled-coil domain containing 47 |
| Target Gene | CCDC47 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | YADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRR |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000009006 (100%)
- Mouse ENSMUSG00000078622 (99%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.