CacheBy
Atlas Antibodies Anti-CCDC181 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CCDC181 Antibody

상품 한눈에 보기

Human CCDC181 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 및 ICC 등 다양한 응용에 적합하며, RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027189-100 Anti-CCDC181 Antibody, coiled-coil domain containing 181 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027189-25 Anti-CCDC181 Antibody, coiled-coil domain containing 181 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CCDC181 Antibody

Anti-CCDC181 Antibody

Target: coiled-coil domain containing 181 (CCDC181)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human CCDC181.


Alternative Gene Names

C1orf114, FLJ25846

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein coiled-coil domain containing 181
Target Gene CCDC181
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EVRRYIMEKIVQANKLLQNQEPVNDKRERKLKFKDQLVDLEVPPLEDTTTSKNYFENERNMFGKLSQLCISNDFGQEDVLLSLTNGSCE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000002860 79%
Mouse ENSMUSG00000026578 79%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.