Thermo Fisher Scientific PAPSS2 Polyclonal Antibody

Applications

Western Blot (WB)

• Tested Dilution: 0.2–1 µg/mL
• Publications: [참조 없음]

Immunohistochemistry (Paraffin) (IHC (P))

• Tested Dilution: 1:600
• Publications: [참조 없음]

Product Specifications

Product Specific Information

• Immunogen sequence:
  PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN

• Storage guidance:
  For short-term use, store at 2–8°C up to 1 week.
  For long-term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

• Predicted homology:
  Cow: 100% | Dog: 100% | Guinea Pig: 100% | Horse: 100% | Human: 100% | Mouse: 93% | Rabbit: 100% | Rat: 100% | Zebrafish: 93%

Target Information

Sulfation is a common modification of endogenous compounds (lipids, proteins, and carbohydrates) and exogenous compounds (xenobiotics and drugs). In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by distinct genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(해당 제품 이미지가 본문에 포함되어 있을 경우 이 섹션에 배치)