CacheBy
Atlas Antibodies Anti-CCDC130 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CCDC130 Antibody

상품 한눈에 보기

인간 CCDC130 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC 및 ICC에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 대한 반응성이 검증되었고, Mouse 및 Rat과 높은 서열 유사성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056977-100 Anti-CCDC130 Antibody, coiled-coil domain containing 130 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056977-25 Anti-CCDC130 Antibody, coiled-coil domain containing 130 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CCDC130 Antibody

Anti-CCDC130 Antibody

Target Protein: Coiled-coil domain containing 130 (CCDC130)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CCDC130.

Alternative Gene Names

  • MGC10471

Open Datasheet

Antigen Information

  • Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    QALQAKASLTIPLVPETEDDRKLAALLKFHTLDSYEDKQKLKRTEIISRSWFPSAPGSASSSKVSGVLKKLAQSRRTALA

Species Reactivity

  • Verified Reactivity: Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000004994 78%
Rat ENSRNOG00000008319 74%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.