
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CBFA2T2 Antibody
상품 한눈에 보기
Human CBFA2T2 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 및 WB에 적합하며, RNA-seq 데이터 기반 Orthogonal 검증 완료. Affinity purification으로 높은 특이성과 재현성 보장. Human에 반응, Mouse 및 Rat과 부분적 상동성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA060523-100 Anti-CBFA2T2 Antibody, core-binding factor, runt domain, alpha subunit 2; translocated to, 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060523-25 Anti-CBFA2T2 Antibody, core-binding factor, runt domain, alpha subunit 2; translocated to, 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CBFA2T2 Antibody
Anti-CBFA2T2 Antibody
Target: core-binding factor, runt domain, alpha subunit 2; translocated to, 2
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - WB (Western Blot)
Product Description
Polyclonal antibody against Human CBFA2T2.
Alternative Gene Names
MTGR1, ZMYND3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | core-binding factor, runt domain, alpha subunit 2; translocated to, 2 |
| Target Gene | CBFA2T2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | MAKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000038533 (57%), Rat ENSRNOG00000016352 (55%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



