CacheBy
Atlas Antibodies Anti-CBFA2T2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CBFA2T2 Antibody

상품 한눈에 보기

Human CBFA2T2 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 및 WB에 적합하며, RNA-seq 데이터 기반 Orthogonal 검증 완료. Affinity purification으로 높은 특이성과 재현성 보장. Human에 반응, Mouse 및 Rat과 부분적 상동성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060523-100 Anti-CBFA2T2 Antibody, core-binding factor, runt domain, alpha subunit 2; translocated to, 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060523-25 Anti-CBFA2T2 Antibody, core-binding factor, runt domain, alpha subunit 2; translocated to, 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CBFA2T2 Antibody

Anti-CBFA2T2 Antibody

Target: core-binding factor, runt domain, alpha subunit 2; translocated to, 2
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human CBFA2T2.


Alternative Gene Names

MTGR1, ZMYND3

Open Datasheet


Target Information

항목 내용
Target Protein core-binding factor, runt domain, alpha subunit 2; translocated to, 2
Target Gene CBFA2T2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MAKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000038533 (57%), Rat ENSRNOG00000016352 (55%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.