
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CASQ2 Antibody
상품 한눈에 보기
인체 CASQ2 단백질에 특이적인 폴리클로날 항체로, 심근 내 칼세퀘스트린 2를 검출합니다. IHC 및 WB 실험에 적합하며, RNA-seq 데이터 기반 정합 검증을 거쳤습니다. 토끼 유래 IgG 항체로 고순도 친화 정제 방식으로 제조되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055298-100 Anti-CASQ2 Antibody, calsequestrin 2 (cardiac muscle) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055298-25 Anti-CASQ2 Antibody, calsequestrin 2 (cardiac muscle) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CASQ2 Antibody
Anti-CASQ2 Antibody
Target Protein: calsequestrin 2 (cardiac muscle)
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using immunohistochemistry (IHC) by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Western Blot (WB)
Product Description
Polyclonal Antibody against Human CASQ2
Alternative Gene Names
PDIB2
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVL
Species Reactivity
- Verified Species: Human
- Interspecies Sequence Identity:
Species Gene ID Identity Rat ENSRNOG00000016243 95% Mouse ENSMUSG00000027861 94%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



