CacheBy
Atlas Antibodies Anti-CARM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CARM1 Antibody

상품 한눈에 보기

Human CARM1 단백질을 인식하는 Rabbit Polyclonal Antibody로, PRMT4 유전자에 대응. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 인체 반응성이 검증된 고품질 연구용 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043561-100 Anti-CARM1 Antibody, coactivator-associated arginine methyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043561-25 Anti-CARM1 Antibody, coactivator-associated arginine methyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CARM1 Antibody

Anti-CARM1 Antibody

Target Information

  • Target Protein: Coactivator-associated arginine methyltransferase 1
  • Target Gene: CARM1
  • Alternative Gene Names: PRMT4

면역세포화학(ICC) 등 다양한 연구용 응용에 적합합니다.

Product Description

Polyclonal Antibody against Human CARM1

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    DVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000032185 (98%)
  • Rat ENSRNOG00000031129 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.