CacheBy
Atlas Antibodies Anti-CAPNS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAPNS2 Antibody

상품 한눈에 보기

Human CAPNS2 단백질을 인식하는 Rabbit Polyclonal 항체로, calpain small subunit 2 연구에 적합합니다. Affinity purification 방식으로 제조되었으며, ICC 등 다양한 응용에 사용 가능합니다. Human 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA076768-100 Anti-CAPNS2 Antibody, calpain small subunit 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076768-25 Anti-CAPNS2 Antibody, calpain small subunit 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAPNS2 Antibody

Anti-CAPNS2 Antibody

Target: calpain small subunit 2
Type: Polyclonal Antibody against Human CAPNS2


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against human CAPNS2 (calpain small subunit 2).
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • MGC12536
  • MGC14804

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein calpain small subunit 2
Target Gene CAPNS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000078144 (86%), Rat ENSRNOG00000045747 (55%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using PrEST antigen

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.