
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CAPG Antibody
상품 한눈에 보기
Human CAPG 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현을 비교 검증하였습니다. Human, Mouse, Rat 반응성이 확인되었으며, PrEST 항원으로 친화 정제되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018843-100 Anti-CAPG Antibody, capping protein (actin filament), gelsolin-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018843-25 Anti-CAPG Antibody, capping protein (actin filament), gelsolin-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CAPG Antibody
Anti-CAPG Antibody
Capping protein (actin filament), gelsolin-like
Recommended Applications
- IHC (Orthogonal Validation): RNA-seq 데이터와 비교하여 고·저 발현 조직에서 단백질 발현을 교차 검증
- WB (Western Blot)
Product Description
Polyclonal Antibody against Human CAPG
Alternative Gene Names
AFCP, MCP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Capping protein (actin filament), gelsolin-like |
| Target Gene | CAPG |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SSPFALELLISDDCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGRESPIFKQF |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000056737 (93%)
- Rat ENSRNOG00000013668 (93%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 조건에 따라 최적 농도는 사용자가 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



