Atlas Antibodies Anti-CALR3 Antibody

상품 한눈에 보기

인간 CALR3 단백질을 인식하는 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합함. Rabbit 호스트에서 생산된 IgG 형 항체이며, PrEST 항원을 이용해 친화 정제됨. 인간 대상 반응성 확인 및 Orthogonal validation 데이터 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043355-100 Anti-CALR3 Antibody, calreticulin 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043355-25 Anti-CALR3 Antibody, calreticulin 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

calreticulin 3

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human CALR3

CRT2, CT93, FLJ25355, MGC26577

항목	내용
Target Protein	calreticulin 3
Target Gene	CALR3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000019732 (78%), Rat ENSRNOG00000013260 (76%)

Antigen Sequence:

FLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRN

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand