AI 생성

1 / 2

Atlas Antibodies Anti-CALCOCO2 Antibody

상품 한눈에 보기

인간 CALCOCO2 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원 기반으로 높은 특이성과 재현성 제공. 토끼 유래 IgG로 인간 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023195-100 Anti-CALCOCO2 Antibody, calcium binding and coiled-coil domain 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023195-25 Anti-CALCOCO2 Antibody, calcium binding and coiled-coil domain 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: calcium binding and coiled-coil domain 2
Type: Polyclonal Antibody against Human CALCOCO2

IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody raised in rabbit against human CALCOCO2 (calcium binding and coiled-coil domain 2).

MGC17318, NDP52

항목	내용
Target Protein	calcium binding and coiled-coil domain 2
Target Gene	CALCOCO2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat (34%), Mouse (33%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand

SINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLT

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet

Enhanced Validation
IHC Orthogonal
WB Independent
ICC

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.