CacheBy
Atlas Antibodies Anti-CACNA2D4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CACNA2D4 Antibody

상품 한눈에 보기

인간 CACNA2D4 단백질을 인식하는 토끼 폴리클로날 항체로, 전압 의존성 칼슘 채널 α2/δ4 서브유닛을 타겟으로 함. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. PBS와 글리세롤 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031952-100 Anti-CACNA2D4 Antibody, calcium channel, voltage-dependent, alpha 2/delta subunit 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031952-25 Anti-CACNA2D4 Antibody, calcium channel, voltage-dependent, alpha 2/delta subunit 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CACNA2D4 Antibody

Anti-CACNA2D4 Antibody

Target: calcium channel, voltage-dependent, alpha 2/delta subunit 4
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human CACNA2D4.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein calcium channel, voltage-dependent, alpha 2/delta subunit 4
Target Gene CACNA2D4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NDFINIIAYNDYVHYIEPCFKGILVQADRDNREHFKLLVEELMVKGVGVVDQALREAFQILKQFQEAKQGSLCNQAIM

Species Reactivity

Verified species: Human

Interspecies identity:

  • Mouse (ENSMUSG00000041460): 91%
  • Rat (ENSRNOG00000008031): 90%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Use gentle mixing before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.