
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CABYR Antibody
상품 한눈에 보기
Human CABYR 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반 직교 검증 수행. Rabbit 유래 IgG로 PrEST 항원을 이용해 친화 정제됨. 다양한 조직에서 CABYR 발현 연구에 적합.
- 카탈로그번호
- HPA047801-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA047801-100 Anti-CABYR Antibody, calcium binding tyrosine-(Y)-phosphorylation regulated 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047801-25 Anti-CABYR Antibody, calcium binding tyrosine-(Y)-phosphorylation regulated 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CABYR Antibody
Anti-CABYR Antibody
Full name: calcium binding tyrosine-(Y)-phosphorylation regulated
Recommended Applications
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human CABYR.
Alternative Gene Names
CBP86, CT88, FSP-2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | calcium binding tyrosine-(Y)-phosphorylation regulated |
| Target Gene | CABYR |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAY |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000047436 (56%), Mouse ENSMUSG00000024430 (55%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



