CacheBy
Atlas Antibodies Anti-CABYR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CABYR Antibody

상품 한눈에 보기

Human CABYR 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반 직교 검증 수행. Rabbit 유래 IgG로 PrEST 항원을 이용해 친화 정제됨. 다양한 조직에서 CABYR 발현 연구에 적합.

카탈로그번호
HPA047801-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047801-100 Anti-CABYR Antibody, calcium binding tyrosine-(Y)-phosphorylation regulated 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047801-25 Anti-CABYR Antibody, calcium binding tyrosine-(Y)-phosphorylation regulated 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CABYR Antibody

Anti-CABYR Antibody

Full name: calcium binding tyrosine-(Y)-phosphorylation regulated

  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human CABYR.

Alternative Gene Names

CBP86, CT88, FSP-2

Open Datasheet

Target Information

항목 내용
Target Protein calcium binding tyrosine-(Y)-phosphorylation regulated
Target Gene CABYR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAY
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000047436 (56%), Mouse ENSMUSG00000024430 (55%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.