CacheBy
Atlas Antibodies Anti-CABLES1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CABLES1 Antibody

상품 한눈에 보기

Human CABLES1 단백질을 인식하는 토끼 폴리클로날 항체로, PrEST 항원을 이용해 친화 정제됨. ICC 등 다양한 응용에 적합하며, 높은 종간 보존성을 가짐. 40% 글리세롤/PBS 완충액에 보존제로 아지드 함유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073649-100 Anti-CABLES1 Antibody, Cdk5 and Abl enzyme substrate 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073649-25 Anti-CABLES1 Antibody, Cdk5 and Abl enzyme substrate 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CABLES1 Antibody

Anti-CABLES1 Antibody

Target Protein: Cdk5 and Abl enzyme substrate 1 (CABLES1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human CABLES1, produced in rabbit and affinity purified using the PrEST antigen.


Alternative Gene Names

FLJ35924, HsT2563


Target Information

항목 내용
Target Protein Cdk5 and Abl enzyme substrate 1
Target Gene CABLES1
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence SRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKN

Verified Species Reactivity

Human


Interspecies Information

유전자 ID 항원 서열 일치율
Mouse ENSMUSG00000040957 94%
Rat ENSRNOG00000012795 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)


Immunocytochemistry (ICC)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.