CacheBy
Atlas Antibodies Anti-CA6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CA6 Antibody

상품 한눈에 보기

인체 CA6 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며 RNA-seq 및 재조합 발현을 통한 정교한 검증 수행. PrEST 항원 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028550-100 Anti-CA6 Antibody, carbonic anhydrase VI 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028550-25 Anti-CA6 Antibody, carbonic anhydrase VI 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CA6 Antibody

Anti-CA6 Antibody

Target: Carbonic anhydrase VI (CA6)
Type: Polyclonal Antibody against Human CA6
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation):
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant Expression Validation):
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against human carbonic anhydrase VI (CA6).
Validated for use in immunohistochemistry (IHC) and western blotting (WB).

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein Carbonic anhydrase VI
Target Gene CA6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYL
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000028972 (60%), Rat ENSRNOG00000021355 (49%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.