Atlas Antibodies Anti-C9orf24 Antibody

상품 한눈에 보기

Human C9orf24 단백질을 인식하는 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교된 신뢰성 높은 단백질 발현 분석에 적합. Rabbit IgG 기반, PrEST 항원으로 친화정제됨. Human 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA053008-100 Anti-C9orf24 Antibody, chromosome 9 open reading frame 24 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA053008-25 Anti-C9orf24 Antibody, chromosome 9 open reading frame 24 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: chromosome 9 open reading frame 24
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human C9orf24

bA573M23.4, CBE1, MGC32921, MGC33614, NYD-SP22, SMRP1

항목	내용
Target Protein	chromosome 9 open reading frame 24
Target Gene	C9orf24
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000013320 (67%), Mouse ENSMUSG00000028441 (66%)

Antigen Sequence:
KYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEARMETAVRGMPLECPPRPERLNAYEREVMVNMLN

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand