Atlas Antibodies Anti-C8orf59 Antibody

상품 한눈에 보기

Human C8orf59 단백질을 인식하는 Rabbit Polyclonal Antibody로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 동일성을 보임. PBS/glycerol buffer에 보존제로 sodium azide 포함.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA071903-100 Anti-C8orf59 Antibody, chromosome 8 open reading frame 59 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA071903-25 Anti-C8orf59 Antibody, chromosome 8 open reading frame 59 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C8orf59 Antibody

Anti-C8orf59 Antibody

Target: Chromosome 8 open reading frame 59 (C8orf59)
Supplier: Atlas Antibodies

Recommended Applications

ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human C8orf59.

Open Datasheet (PDF)

Target Information

Target Protein: Chromosome 8 open reading frame 59
Target Gene: C8orf59
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:

MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKVLH

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse (ENSMUSG00000078784): 85%
Rat (ENSRNOG00000038902): 80%

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2)
Preservative	0.02% sodium azide
MSDS	Material Safety Data Sheet