CacheBy
Atlas Antibodies Anti-C6orf132 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C6orf132 Antibody

상품 한눈에 보기

Human C6orf132 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간에 대해 검증되었으며, Orthogonal validation 데이터 기반으로 신뢰성이 높습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044588-100 Anti-C6orf132 Antibody, chromosome 6 open reading frame 132 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044588-25 Anti-C6orf132 Antibody, chromosome 6 open reading frame 132 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C6orf132 Antibody

Anti-C6orf132 Antibody

Target: chromosome 6 open reading frame 132


  • IHC (Immunohistochemistry) — Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human C6orf132


Alternative Gene Names

  • bA7K24.2

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 6 open reading frame 132
Target Gene C6orf132
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence QGTFSKLFGKKHTTTPSTSLYATNPPWIFTQEAPEEGTGGFDGIYYGDNRFNTVSESGTATLKARPRVRPLLTFLPLNAQEN

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000015297 (90%), Mouse ENSMUSG00000034382 (88%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.