CacheBy
Atlas Antibodies Anti-C4orf19 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C4orf19 Antibody

상품 한눈에 보기

인체 C4orf19 단백질을 인식하는 고품질 폴리클로날 항체입니다. IHC 및 ICC 실험에 적합하며 RNA-seq 데이터와의 직교 검증으로 신뢰성 향상. 친화성 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043458-100 Anti-C4orf19 Antibody, chromosome 4 open reading frame 19 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043458-25 Anti-C4orf19 Antibody, chromosome 4 open reading frame 19 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C4orf19 Antibody

Anti-C4orf19 Antibody

Target: chromosome 4 open reading frame 19
Supplier: Atlas Antibodies

  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human C4orf19

Alternative Gene Names

  • FLJ11017

Open Datasheet

Target Information

항목 내용
Target Protein chromosome 4 open reading frame 19
Target Gene C4orf19
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000060512 (47%), Rat ENSRNOG00000002191 (44%)

Antigen Sequence:
VPSPGYVNEVNSCKLDEDDTDKLKGKWSSEVLVQKNDPQRQGSKKTESSSRTADPWEPCWPHQGPLPQGDAGGEHHACGVNGIGPAATPQPTGNSSPT

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.