CacheBy
Atlas Antibodies Anti-C3orf49 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C3orf49 Antibody

상품 한눈에 보기

Human C3orf49 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 연구용에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Human에 반응하며, Rat 및 Mouse와 부분적 상동성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053582-100 Anti-C3orf49 Antibody, chromosome 3 open reading frame 49 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053582-25 Anti-C3orf49 Antibody, chromosome 3 open reading frame 49 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C3orf49 Antibody

Anti-C3orf49 Antibody

Target: Chromosome 3 open reading frame 49 (C3orf49)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C3orf49 protein.
This antibody is affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Chromosome 3 open reading frame 49
Target Gene C3orf49
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RAQPQLYLPEPFKIAYRKVGQCRRFQQLKKKNGSFKRKGIERWHRAVSTNLLKQNVLVPKEESSSDSDMGFHESQQNQKSNLKTKVK

Species Reactivity

항목 내용
Verified Reactivity Human
Interspecies Information Rat ENSRNOG00000027633 (62%), Mouse ENSMUSG00000030850 (23%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

IHC Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.