CacheBy
Thermo Fisher Scientific LIPN Polyclonal Antibody
원본
Thermo Fisher Scientific

Thermo Fisher Scientific LIPN Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 LIPN Polyclonal Antibody는 인간 LIPN 단백질을 인식하는 토끼 유래 IgG 항체입니다. Western blot 검증 완료, 고순도 친화 크로마토그래피 정제, PBS/sucrose 저장 완충액 구성으로 안정적이며 연구용으로 적합합니다.

브랜드
Thermo Fisher Scientific
카테고리
Polyclonal Antibodies
판매단위
pk

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 07:54
Thermo Fisher Scientific PA545806 LIPN Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
630,500원VAT 포함 693,550원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Thermo Fisher Scientific · Thermo Fisher Scientific LIPN Polyclonal Antibody

Applications

  • Western Blot (WB): 1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide directed towards the C-terminal of human LIPN (aa 211–260)
Conjugate Unconjugated
Form Liquid
Concentration 0.5 mg/mL
Purification Affinity Chromatography
Storage Buffer PBS with 2% sucrose
Contains 0.09% sodium azide
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Wet ice
RRID AB_2607428

Product Specific Information

  • Peptide sequence: IFTRFFLLPNSIIKAVFGTKGFFLEDKKTKIASTKICNNKILWLICSEFM
  • Sequence homology: Human: 100%

Target Information

The LIPN gene encodes a lipase highly expressed in granular keratinocytes of the epidermis. It plays a role in keratinocyte differentiation. Mutations in this gene are associated with lamellar ichthyosis type 4.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기
Thermo Fisher ScientificThermo Fisher Scientific RIN2 Polyclonal Antibody630,500원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific FYCO1 Polyclonal Antibody630,500원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific LYPLAL1 Polyclonal Antibody630,500원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific DMKN Polyclonal Antibody630,500원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.