CacheBy
Atlas Antibodies Anti-PPIP5K1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPIP5K1 Antibody

상품 한눈에 보기

Human PPIP5K1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. 40% glycerol/PBS 버퍼에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039380-100 Anti-PPIP5K1 Antibody, diphosphoinositol pentakisphosphate kinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039380-25 Anti-PPIP5K1 Antibody, diphosphoinositol pentakisphosphate kinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPIP5K1 Antibody

Anti-PPIP5K1 Antibody

Target: diphosphoinositol pentakisphosphate kinase 1 (PPIP5K1)
Type: Polyclonal Antibody against Human PPIP5K1


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human PPIP5K1.
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

HISPPD2A, IPS1, KIAA0377, VIP1

Open Datasheet


Target Information

항목 내용
Target Protein diphosphoinositol pentakisphosphate kinase 1
Target Gene PPIP5K1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence CLENSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVIQPYQEFSVEVGRLAQETSAINLLSQGIPEIDKPS
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000033526 (60%), Rat ENSRNOG00000014436 (57%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.