CacheBy
Atlas Antibodies Anti-PPIC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPIC Antibody

상품 한눈에 보기

Human PPIC(cyclophilin C)을 인식하는 rabbit polyclonal antibody로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039163-100 Anti-PPIC Antibody, peptidylprolyl isomerase C (cyclophilin C) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039163-25 Anti-PPIC Antibody, peptidylprolyl isomerase C (cyclophilin C) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPIC Antibody

Anti-PPIC Antibody

Target: peptidylprolyl isomerase C (cyclophilin C)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human PPIC (peptidylprolyl isomerase C, cyclophilin C).

Alternative Gene Names: CYPC
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG


  • Immunohistochemistry (IHC)

Target Information

항목 내용
Target Protein peptidylprolyl isomerase C (cyclophilin C)
Target Gene PPIC
Alternative Gene Name CYPC
Verified Species Reactivity Human
Interspecies Homology Mouse (88%), Rat (86%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence VFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADW

Purification and Buffer

항목 내용
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.