
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPIC Antibody
상품 한눈에 보기
Human PPIC(cyclophilin C)을 인식하는 rabbit polyclonal antibody로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 특이성과 재현성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039163-100 Anti-PPIC Antibody, peptidylprolyl isomerase C (cyclophilin C) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039163-25 Anti-PPIC Antibody, peptidylprolyl isomerase C (cyclophilin C) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPIC Antibody
Anti-PPIC Antibody
Target: peptidylprolyl isomerase C (cyclophilin C)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human PPIC (peptidylprolyl isomerase C, cyclophilin C).
Alternative Gene Names: CYPC
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | peptidylprolyl isomerase C (cyclophilin C) |
| Target Gene | PPIC |
| Alternative Gene Name | CYPC |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (88%), Rat (86%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | VFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADW |
Purification and Buffer
| 항목 | 내용 |
|---|---|
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



