CacheBy
Atlas Antibodies Anti-PPARGC1B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPARGC1B Antibody

상품 한눈에 보기

Human PPARGC1B 단백질을 인식하는 토끼 폴리클로날 항체로, peroxisome proliferator-activated receptor gamma coactivator 1 beta를 타깃으로 함. PrEST 항원 기반 친화 정제. 인간 반응성 검증 완료. ICC 등 다양한 응용에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050543-100 Anti-PPARGC1B Antibody, peroxisome proliferator-activated receptor gamma, coactivator 1 beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050543-25 Anti-PPARGC1B Antibody, peroxisome proliferator-activated receptor gamma, coactivator 1 beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPARGC1B Antibody

Anti-PPARGC1B Antibody

Target: peroxisome proliferator-activated receptor gamma, coactivator 1 beta
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PPARGC1B.


Alternative Gene Names

  • PERC
  • PGC1B

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein peroxisome proliferator-activated receptor gamma, coactivator 1 beta
Target Gene PPARGC1B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence IKHSLGKEIALSLPSPEGLSLKATPGAAHKLPKKHPERSELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLR

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000033871 80%
Rat ENSRNOG00000017503 80%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

성분 내용
Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.