CacheBy
Atlas Antibodies Anti-PPA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPA1 Antibody

상품 한눈에 보기

Human PPA1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 검증 완료. 높은 종 간 반응성과 특이성을 제공하며, PrEST 항원으로 친화 정제됨. 40% glycerol 기반 PBS buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020096-100 Anti-PPA1 Antibody, pyrophosphatase (inorganic) 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020096-25 Anti-PPA1 Antibody, pyrophosphatase (inorganic) 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPA1 Antibody

Anti-PPA1 Antibody

Target: pyrophosphatase (inorganic) 1
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human PPA1

Alternative Gene Names

IOPPP, PP, PP1, Ppase, SID6-8061

Open Datasheet

Target Information

항목 내용
Target Protein pyrophosphatase (inorganic) 1
Target Gene PPA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAK

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000020089 95%
Rat ENSRNOG00000000557 91%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Application
WB Application
Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.