CacheBy
Atlas Antibodies Anti-POPDC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-POPDC2 Antibody

상품 한눈에 보기

인간 POPDC2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반의 직교 검증을 통해 단백질 발현을 확인할 수 있습니다. 토끼에서 생산된 IgG 형 항체이며, 친화 정제된 고품질 시약입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024255-100 Anti-POPDC2 Antibody, popeye domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024255-25 Anti-POPDC2 Antibody, popeye domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-POPDC2 Antibody

Anti-POPDC2 Antibody

Target: popeye domain containing 2 (POPDC2)
Supplier: Atlas Antibodies


  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human POPDC2


Alternative Gene Names

  • POP2

Open Datasheet


Target Information

항목 내용
Target Protein popeye domain containing 2
Target Gene POPDC2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (79%), Mouse (79%)

Antigen Sequence

TAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYDISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLGPTAADAGPESEKGDEEVCEPAVSPPQATPTSLQQTPPCSTPPATTNFPAPPT

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 농도 및 조건
Glycerol 40%
PBS pH 7.2
Sodium Azide 0.02% (preservative)

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.