Atlas Antibodies Anti-POLR3H Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA046787-100 | - | Atlas Antibodies HPA046787-100 Anti-POLR3H Antibody, polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA046787-25 | - | Atlas Antibodies HPA046787-25 Anti-POLR3H Antibody, polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-POLR3H Antibody
polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human POLR3H
Alternative Gene Names
KIAA1665, RPC8
Target Protein
polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)
Target Gene
POLR3H
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
GFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVG
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000022476 (97%)
Rat ENSRNOG00000004471 (97%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|