AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-POLR2M Antibody
상품 한눈에 보기
Human POLR2M 단백질에 대한 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. GCOM1, Gdown1 등 다양한 유전자명으로 알려진 POLR2M을 인식하며, PrEST 항원으로 친화 정제되었습니다. 인간 반응성이 검증되어 연구용으로 신뢰성 높습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA068141-100 Anti-POLR2M Antibody, polymerase (RNA) II (DNA directed) polypeptide M 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068141-25 Anti-POLR2M Antibody, polymerase (RNA) II (DNA directed) polypeptide M 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-POLR2M Antibody
Anti-POLR2M Antibody
Target Information
- Target Protein: polymerase (RNA) II (DNA directed) polypeptide M
- Target Gene: POLR2M
- Alternative Gene Names: GCOM1, Gdown, Gdown1, GRINL1A
Product Description
Polyclonal antibody against Human POLR2M.
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
SSQAEDTSSSFDNLFIDRLQRITIADQGEQQSEENASTKNLTGLSSGTEKKPHYMEVLEMRAK
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000057676 | 70% |
| Mouse | ENSMUSG00000032199 | 67% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.