
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-POLR2E Antibody
상품 한눈에 보기
Human POLR2E 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 실험에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간, 생쥐, 랫트에서 높은 교차 반응성을 보입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA063030-100 Anti-POLR2E Antibody, polymerase (RNA) II (DNA directed) polypeptide E, 25kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063030-25 Anti-POLR2E Antibody, polymerase (RNA) II (DNA directed) polypeptide E, 25kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-POLR2E Antibody
Anti-POLR2E Antibody
polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
Recommended Applications
- WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human POLR2E
Alternative Gene Names
hRPB25, hsRPB5, RPABC1, RPB5, XAP4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | polymerase (RNA) II (DNA directed) polypeptide E, 25kDa |
| Target Gene | POLR2E |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRY |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000013545 (99%), Mouse ENSMUSG00000004667 (99%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



