CacheBy
Atlas Antibodies Anti-POLR1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-POLR1A Antibody

상품 한눈에 보기

Human POLR1A 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤과 PBS 완충액에 보존되어 안정적입니다. HUMAN 종에 대해 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031513-100 Anti-POLR1A Antibody, polymerase (RNA) I polypeptide A, 194kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031513-25 Anti-POLR1A Antibody, polymerase (RNA) I polypeptide A, 194kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-POLR1A Antibody

Anti-POLR1A Antibody

Target Protein: polymerase (RNA) I polypeptide A, 194kDa

Recommended Applications:

  • Immunohistochemistry (IHC)


Product Description

Polyclonal antibody against Human POLR1A.


Alternative Gene Names

DKFZP586M0122, FLJ21915, RPA1, RPO1-4

Open Datasheet (PDF)


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

SNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHPNTLLRRGAFLSYSQKIQEAVKALKLESENRNGRSPGTQEMLRMWYELDEESRRKYQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000009545 (76%)
  • Mouse ENSMUSG00000049553 (73%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.