
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-POLN Antibody
상품 한눈에 보기
Human POLN 단백질을 표적으로 하는 Rabbit Polyclonal 항체. Affinity purification으로 높은 특이성과 재현성 확보. ICC 등 다양한 연구 응용에 적합. Glycerol/PBS buffer에 보존되어 장기 안정성 우수.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035939-100 Anti-POLN Antibody, polymerase (DNA directed) nu 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035939-25 Anti-POLN Antibody, polymerase (DNA directed) nu 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-POLN Antibody
Anti-POLN Antibody
Product Description
Polyclonal antibody against Human polymerase (DNA directed) nu (POLN).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended Applications
- Immunocytochemistry (ICC)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | polymerase (DNA directed) nu |
| Target Gene | POLN |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (78%), Rat (78%) |
Antigen Sequence:
FSTLTSQWKDVPVEQVTHADREQTKKVVYAVVYGAGKERLAACLGVPIQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRR
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



