CacheBy
Atlas Antibodies Anti-POLE2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-POLE2 Antibody

상품 한눈에 보기

Human POLE2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 사용 가능. PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 기반 Orthogonal 검증 완료. 인체 유래 단백질 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027555-100 Anti-POLE2 Antibody, polymerase (DNA directed), epsilon 2, accessory subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027555-25 Anti-POLE2 Antibody, polymerase (DNA directed), epsilon 2, accessory subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-POLE2 Antibody

Anti-POLE2 Antibody

polymerase (DNA directed), epsilon 2, accessory subunit


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Orthogonal validation)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human POLE2


Alternative Gene Names

  • DPE2

Open Datasheet


Target Information

항목 내용
Target Protein polymerase (DNA directed), epsilon 2, accessory subunit
Target Gene POLE2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NAVEKQPLSSNMIERSVVEAAVQECSQSVDETIEHVFNIIGAFDIPRFVYNSERKKFLPLLMTNHPAPNLFGTPRDKAEMFRERYTILHQRTHRHELFTPPVIGSHPDESGSKFQLKTIETLLGSTTKIGDAIVLG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000004242 (90%)
  • Mouse ENSMUSG00000020974 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.