CacheBy
Atlas Antibodies Anti-POLA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-POLA2 Antibody

상품 한눈에 보기

Human POLA2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증됨. Affinity purification으로 높은 특이성과 안정성 확보. PBS/glycerol buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037570-100 Anti-POLA2 Antibody, polymerase (DNA directed), alpha 2, accessory subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037570-25 Anti-POLA2 Antibody, polymerase (DNA directed), alpha 2, accessory subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-POLA2 Antibody

Anti-POLA2 Antibody

polymerase (DNA directed), alpha 2, accessory subunit


  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human POLA2


Alternative Gene Names

  • FLJ21662

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein polymerase (DNA directed), alpha 2, accessory subunit
Target Gene POLA2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence IMEGINTTGRKLVATKLYEGVPLPFYQPTEEDADFEQSMVLVACGPYTTSDSITYDPLLDLIAVINHDRPDVCILFGPFLDAKHEQVENCL
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000020906 (90%), Mouse ENSMUSG00000024833 (86%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.