CacheBy
Atlas Antibodies Anti-PODXL2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PODXL2 Antibody

상품 한눈에 보기

Human PODXL2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 고순도 IgG 형식으로 제공됩니다. 인간 반응성이 검증되었으며, 보존제로 sodium azide를 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042265-100 Anti-PODXL2 Antibody, podocalyxin-like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042265-25 Anti-PODXL2 Antibody, podocalyxin-like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PODXL2 Antibody

Anti-PODXL2 Antibody

Target: podocalyxin-like 2 (PODXL2)
Type: Polyclonal Antibody against Human PODXL2


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against human PODXL2 protein. It is affinity purified using the PrEST antigen as an affinity ligand.


Alternative Gene Names

  • endoglycan
  • PODLX2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein podocalyxin-like 2
Target Gene PODXL2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
EAQSRIPWDSTQVICKDWSNLAGKNYIILNMTENIDCEVFRQHRGPQLLALVEEVLPRHGSGHHGAWHISLSKPSEKEQHLLMTLVGEQGVVPTQDVLSMLGDIRRSLEEIGIQNYSTTSS


Species Reactivity

Verified Species: Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000033152 (90%)
  • Rat ENSRNOG00000016255 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.