CacheBy
Atlas Antibodies Anti-PNPT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PNPT1 Antibody

상품 한눈에 보기

Human PNPT1 단백질을 타깃으로 한 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인간, 랫드, 마우스 간 교차 반응성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034602-100 Anti-PNPT1 Antibody, polyribonucleotide nucleotidyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034602-25 Anti-PNPT1 Antibody, polyribonucleotide nucleotidyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PNPT1 Antibody

Anti-PNPT1 Antibody

Target: polyribonucleotide nucleotidyltransferase 1 (PNPT1)
Type: Polyclonal Antibody (Rabbit)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Independent Antibody Validation)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against human PNPT1.


Alternative Gene Names

DFNB70, old-35, OLD35, PNPase

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein polyribonucleotide nucleotidyltransferase 1
Target Gene PNPT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FMPLVVDYRQKAAAAGRIPTNYLRREIGTSDKEILTSRIIDRSIRPLFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSLSDIPWNGPVGAVR
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000003600 (95%), Mouse ENSMUSG00000020464 (93%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.