
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PNRC1 Antibody
상품 한눈에 보기
Human PNRC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. PrEST 항원으로 특이적 정제되었으며, 높은 종 간 보존성을 가집니다. 40% glycerol/PBS 버퍼에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA066513-100 Anti-PNRC1 Antibody, proline-rich nuclear receptor coactivator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066513-25 Anti-PNRC1 Antibody, proline-rich nuclear receptor coactivator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PNRC1 Antibody
Anti-PNRC1 Antibody
Target: Proline-rich nuclear receptor coactivator 1 (PNRC1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human PNRC1.
Alternative Gene Names
B4-2, PROL2, PRR2
Target Information
- Target Protein: Proline-rich nuclear receptor coactivator 1
- Target Gene: PNRC1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPK
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000040128 (92%)
- Rat ENSRNOG00000007793 (91%)
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



