CacheBy
Atlas Antibodies Anti-PNRC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PNRC1 Antibody

상품 한눈에 보기

Human PNRC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. PrEST 항원으로 특이적 정제되었으며, 높은 종 간 보존성을 가집니다. 40% glycerol/PBS 버퍼에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA066513-100 Anti-PNRC1 Antibody, proline-rich nuclear receptor coactivator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066513-25 Anti-PNRC1 Antibody, proline-rich nuclear receptor coactivator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PNRC1 Antibody

Anti-PNRC1 Antibody

Target: Proline-rich nuclear receptor coactivator 1 (PNRC1)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human PNRC1.

Alternative Gene Names

B4-2, PROL2, PRR2

Open Datasheet (PDF)

Target Information

  • Target Protein: Proline-rich nuclear receptor coactivator 1
  • Target Gene: PNRC1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    QLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPK

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000040128 (92%)
  • Rat ENSRNOG00000007793 (91%)

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.