CacheBy
Atlas Antibodies Anti-PNPO Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PNPO Antibody

상품 한눈에 보기

인간 PNPO 단백질을 인식하는 토끼 폴리클로날 항체로 IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. PBS/glycerol 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027776-100 Anti-PNPO Antibody, pyridoxamine 5`-phosphate oxidase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027776-25 Anti-PNPO Antibody, pyridoxamine 5`-phosphate oxidase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PNPO Antibody

Anti-PNPO Antibody

Target Protein: pyridoxamine 5'-phosphate oxidase
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Validation of protein expression by comparing independent antibodies targeting different epitopes.
  • WB (Western Blot) – Validation of protein expression by comparing independent antibodies targeting different epitopes.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human PNPO (pyridoxamine 5'-phosphate oxidase).


Alternative Gene Names

  • PDXPO

Target Information

항목 내용
Target Protein pyridoxamine 5'-phosphate oxidase
Target Gene PNPO
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000018659 (92%), Rat ENSRNOG00000046493 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.