
1 / 2
Atlas Antibodies Anti-PNMA3 Antibody
상품 한눈에 보기
Human PNMA3 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, paraneoplastic Ma antigen 3 검출에 적합. IHC 등 다양한 응용에 사용 가능. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PNMA3 Antibody
Target: Paraneoplastic Ma antigen 3 (PNMA3)
Product Description
Polyclonal antibody against Human PNMA3.
Recommended Applications
- Immunohistochemistry (IHC)
- Other validated applications may apply
Alternative Gene Names
MA3, MA5, MGC132756, MGC132758
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Paraneoplastic Ma antigen 3 |
| Target Gene | PNMA3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PRPPARITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKRKRHTFCYSCG |
Species Reactivity
- Verified: Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000052022 | 50% |
| Mouse | ENSMUSG00000046287 | 46% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 농도 및 조건 |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium azide | 0.02% (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PNMA5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNMA6A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNMA3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNMA6A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNMA1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.