CacheBy
Atlas Antibodies Anti-PNCK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PNCK Antibody

상품 한눈에 보기

Human PNCK 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. Rabbit에서 생산된 IgG 형태이며, PrEST 항원으로 특이적 정제되었습니다. 높은 종간 반응성(96% Rat/Mouse)으로 다양한 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007458-100 Anti-PNCK Antibody, pregnancy up-regulated nonubiquitous CaM kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007458-25 Anti-PNCK Antibody, pregnancy up-regulated nonubiquitous CaM kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PNCK Antibody

Anti-PNCK Antibody

Target Information

  • Protein: Pregnancy up-regulated nonubiquitous CaM kinase
  • Gene: PNCK
  • Alternative Gene Names: CaMK1b, MGC45419

Product Description

Polyclonal antibody against human PNCK.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    MLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPN

Species Reactivity

  • Verified Species: Human
  • Interspecies Identity:
    • Rat (ENSRNOG00000058317): 96%
    • Mouse (ENSMUSG00000002012): 96%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage & Handling Gently mix before use. Optimal concentrations and conditions should be determined by the user.
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Reference Documents

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.