CacheBy
Atlas Antibodies Anti-PM20D2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PM20D2 Antibody

상품 한눈에 보기

인간 PM20D2 단백질을 인식하는 토끼 폴리클로날 항체입니다. Western blot과 ICC에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤과 PBS(pH 7.2) 버퍼에 보존되어 있습니다. 인간 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030326-100 Anti-PM20D2 Antibody, peptidase M20 domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030326-25 Anti-PM20D2 Antibody, peptidase M20 domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PM20D2 Antibody

Anti-PM20D2 Antibody

Target: peptidase M20 domain containing 2 (PM20D2)
Type: Polyclonal Antibody against Human PM20D2


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody generated in rabbit against the human PM20D2 protein.


Alternative Gene Names

ACY1L2, bA63L7.3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein peptidase M20 domain containing 2
Target Gene PM20D2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AFTNLDVVFMAHPSQENAAYLPDMAEHDVTVKYYGKASHSASYPWEGLNALDAAVLAYNNLSVFRQQMKPTWR

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000054659 90%
Rat ENSRNOG00000007755 90%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.