
1 / 2
Atlas Antibodies Anti-PLXNA3 Antibody
상품 한눈에 보기
인간 PLXNA3 단백질을 인식하는 폴리클로날 항체입니다. Rabbit에서 생산된 IgG 형식으로 WB 및 ICC에 적합합니다. PrEST 항원으로 친화정제되었으며, 40% glycerol/PBS 완충액에 보존제를 포함합니다. 인간 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PLXNA3 Antibody
Product Description
Polyclonal antibody against Human PLXNA3 (plexin A3). Recommended for use in Western Blot (WB) and Immunocytochemistry (ICC).
Alternative Gene Names
6.3, Plxn3, PLXN4, SEX, XAP-6
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | plexin A3 |
| Target Gene | PLXNA3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일성 |
|---|---|---|
| Rat | ENSRNOG00000060464 | 86% |
| Mouse | ENSMUSG00000031398 | 84% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PLXNA4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLXNA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLXNA3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLVAP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLSCR5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.