
1 / 2
Atlas Antibodies Anti-PLSCR3 Antibody
상품 한눈에 보기
인간 PLSCR3 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. 인산지질 스크램블레이스 3 검출에 적합하며, 높은 종간 반응성(인간·마우스·랫트)과 높은 특이성을 제공합니다. Affinity purification으로 높은 순도 확보.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PLSCR3 Antibody
Target Information
- Target Protein: Phospholipid scramblase 3
- Target Gene: PLSCR3
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFG
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000019461): 94%
- Rat (ENSRNOG00000027914): 91%
Product Description
Polyclonal antibody against human PLSCR3.
Recommended Applications
- Immunocytochemistry (ICC)
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Storage Note | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PLSCR5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLSCR4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLSCR3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLSCR3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLSCR1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.