Atlas Antibodies Anti-PLSCR3 Antibody

상품 한눈에 보기

인간 PLSCR3 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. 인산지질 스크램블레이스 3 검출에 적합하며, 높은 종간 반응성(인간·마우스·랫트)과 높은 특이성을 제공합니다. Affinity purification으로 높은 순도 확보.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA068609-100 Anti-PLSCR3 Antibody, phospholipid scramblase 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA068609-25 Anti-PLSCR3 Antibody, phospholipid scramblase 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Phospholipid scramblase 3
Target Gene: PLSCR3
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
PFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFG
```

Highest antigen sequence identity to the following orthologs:

Polyclonal antibody against human PLSCR3.

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Storage Note	Gently mix before use. Optimal concentrations and conditions should be determined by the user.