
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PLEKHN1 Antibody
상품 한눈에 보기
인체 PLEKHN1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 40% 글리세롤/PBS 완충액에 보존 처리됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031742-100 Anti-PLEKHN1 Antibody, pleckstrin homology domain containing, family N member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031742-25 Anti-PLEKHN1 Antibody, pleckstrin homology domain containing, family N member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PLEKHN1 Antibody
Anti-PLEKHN1 Antibody
Target: pleckstrin homology domain containing, family N member 1 (PLEKHN1)
Type: Polyclonal Antibody against Human PLEKHN1
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody raised in rabbit against human PLEKHN1 protein.
Alternative Gene Names
- DKFZP434H2010
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | pleckstrin homology domain containing, family N member 1 |
| Target Gene | PLEKHN1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | IFSEELDGLCFKGELPLRAVHINLEEKEKQIRSFLIEGPLINTIRVVCASYEDYGHWLLCLRAVTHREGAPPLPGAESFPGSQV |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000020295 | 80% |
| Mouse | ENSMUSG00000078485 | 77% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



